PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo3G0109000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family TALE
Protein Properties Length: 184aa    MW: 20939.7 Da    PI: 10.1583
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo3G0109000genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox283.8e-091151492155
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     + +yps++e++ L +++gLt++q+++WF N+R ++
  Spipo3G0109000 115 SWPYPSESEKAALVASTGLTQNQISNWFINQRKRH 149
                     569*****************************885 PP

2ELK27.66.8e-106889122
             ELK  1 ELKhqLlrKYsgyLgsLkqEFs 22
                    ELK  Ll+ Y+++L+sLkqE+s
  Spipo3G0109000 68 ELKSDLLKRYGEHLCSLKQELS 89
                    9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF037892.1E-56889IPR005539ELK domain
SMARTSM011883.2E-46889IPR005539ELK domain
PROSITE profilePS512139.5166888IPR005539ELK domain
PROSITE profilePS5007112.47189152IPR001356Homeobox domain
SuperFamilySSF466895.56E-1790159IPR009057Homeodomain-like
SMARTSM003891.5E-1191156IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.2E-2694154IPR009057Homeodomain-like
CDDcd000862.65E-10101153No hitNo description
PfamPF059207.1E-17109148IPR008422Homeobox KN domain
PROSITE patternPS000270127150IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MAEKEVKMSH VVSAEHWAHV RRTTYLWARS KEAQKENVGD SWSSEEHGDA CGRGRALAED  60
RQRAMGRELK SDLLKRYGEH LCSLKQELSK KKTKKSKLPK EARQKLLIWW ELHYSWPYPS  120
ESEKAALVAS TGLTQNQISN WFINQRKRHW KPSEDARSAV GQGLPLPTAV QFYLADGPSQ  180
AGL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015572849.17e-42PREDICTED: homeotic protein knotted-1
RefseqXP_013465932.12e-41homeobox knotted-like protein
SwissprotP466391e-42KNAT1_ARATH; Homeobox protein knotted-1-like 1
TrEMBLH9CW643e-42H9CW64_ARATH; KNAT1/BP transcription factor splice variant
TrEMBLA5Y4G74e-42A5Y4G7_MEDTR; Class I KNOX homeobox transcription factor (Fragment)
STRINGAT4G08150.12e-40(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.17e-38KNOTTED-like from Arabidopsis thaliana